USA Directory > Business > Business Services

  • Network management and configuration service providers
    Privately held and steadily profitable, LogicVein has been focused on the network management domain for over a decade as a respected provider of innovative solutions. We are pleased to introduce Net LineDancer.
    US www.logicvein.com/
  • Social Media Content Creation & Management Company
    A top social media management company & agency. We've helped small businesses rapidly grow. Get results with our social media and SEO services.
    US digitalmediarun.com/
  • Miltees Sprinkler And Valve Repair LLC - (805) 303-5142
    Lawn Sprinkler, Lawn Sprinkler System, Lawn Sprinkler Repair, Lawn Sprinkler Installation, Professional Sprinkler Repair Miltees Sprinkler And Valve Repair LLC provide excellent Lawn Sprinkler Systems in Simi Valley, CA. Don't hesitate to contact us now! Westlake Village CA; Fillmore CA; Encino CA; Topanga CA; Hidden Hills CA;Professional Local Lawn Services, Affordable Commercial Sprinkler Services, Professional Residential Lawn Expert, Professional Commercial Sprinkler Cleaning, Affordable Landscaping Services Expert, Professional Residential Lawn Cleaning, Dependable Local Sprinkler Services, Reliable Local Lawn Services, Reliable Commercial Sprinkler Cleaning, Quality Affordable Lawn Cleaning.
    US lawnsprinklersystemssimivalley.com/
  • RJ Tree Service Pros
    RJ Tree Service Pros is an insured and licensed tree removal company that serves Durham and the surrounding areas. We are experts in tree removal, tree trimming & pruning, land clearing & more. Your trusted & professional tree service company in Durham NC
    US www.treeserviceprosdurham.com/
  • Alpine Garage Door Repair Rockdale Co.
    We provide top-quality garage door services! From garage door repair to garage door maintenance and new garage door installation, our technicians can do it all. Alpine Garage Doors is one of the leading garage door companies offering top-quality service and products to its customers. We have been in the garage door industry for more than 10 years with many satisfied customers. Our team of garage door technicians is very skilled and highly experienced. We have the solution to every garage door problem. We offer different garage door services such as repair, maintenance, and installation. With all our years of experience, we have the skills and knowledge to deal with every garage door make and model. You can call us anytime for top-rated garage door service and our technicians are available 24/7 to assist you.
    US alpinegaragedoorstx.com/locations/rockdale/
  • CW Dumpsters, LLC
    We locate at: Jacksonville, FL 32234 USA. Call us: (904) 591-7431
    US www.rentcwdumpsters.com
  • Boss Services, Inc.
    Whether it is painting your home, adding a deck or an addition onto your home that meets the highest quality standards for engineering safety, structural integrity and craftsmanship, Boss Services, Inc. is the right choice. Holding ourselves to a higher standard since our conception in 1988, we have grown to become one of New England’s most successful custom residential building, remodeling and painting companies. We have assembled a team of the finest-trained carpenters, painters, designers, architects, and engineers available.
    US www.bossservicesinc.com
  • IPTVRESALE VS SSTV IPTV Comparison ,Who Is The Best IPTV
    IPTV is much more than just on-demand video and lives TV broadcasts and streaming channels. Apps are used to stream content by IPTV service providers. Only a smart TV or computer with an internet connection can be used to stream content from some providers. It’s vital to keep in mind that certain IPTV service providers only provide access using a certain device at a time. Even though some enable concurrent streaming on many devices. You must choose how and when to access your stuff in light of this. Once you’ve chosen your preferred device. You’ll need to focus your search on IPTV service providers who can accommodate it. I think everyone has a certain preference for the types of things they enjoy seeing. It’s crucial to review the list of channels offered before choosing your next IPTV service provider. Consider whether they satisfy your entertainment demands. Different bundles are available from a variety of suppliers.
    US iptvresale.com/
  • GoldMaids Team
    Address: 3806 Falling Acorn Cir, Lake Mary, FL 32746 Phone: 407-480-7439 GoldMaids Team delivers professional residential and commercial cleaning services in Lake Mary & surrounding areas in Central Florida to help promote healthy work & home environments.
    US www.goldmaidsteam.com
  • The Dumpster Divers
    We Locate at: 3A Industrial Dr, Shrewsbury, MA 01545, Call us at: (508) 925-5245
    US www.thedumpsterdivers.com/
  • Apopka Tree Pros
    Are you looking for outstanding, affordable tree service in Apopka? Look no further! Apopka Tree Pros can help. We are a fully licensed and insured tree service company in Apopka, Florida. We have the highest trained professionals and latest equipment to complete any tree trimming or tree removal, from small residential yards to larger commercial jobs. We do: Tree trimming, tree removals, land clearing, stump grinding, storm removal. Call us today for a FREE Estimate
    US www.apopkatreepros.com
  • G Brothers Garage Doors
    G Brothers Garage Doors handles all your Lakewood & Denver garage door needs, you can be sure that you’re receiving quality services from a garage door company that you can trust.
    US www.gbrothersgaragedoors.com/
  • South Shore Custom Cabinets
    South Shore Custom Cabinets is headquartered in Quincy, MA but serves the entire South Shore of Massachusetts in all types of custom cabinetry and woodwork. We design and install custom kitchen cabinets and custom bathroom cabinets and vanities. We have built all kinds of both residential built-ins and commercial built-ins such as offices, display cabinets, shelving, storage, etc. We also built customer furniture such as beds, tables, desks, dressers, etc. We are also known for our architectural woodworking such as molding, mantles, handrails, etc. We can create and install any custom idea you have for your home. Make an appointment to discuss the possibilities with our professional team today.
    US www.southshorecustomcabinets.com
  • Spirinity Productions
    Spirinity Productions is the premier production company serving the greater Los Angeles area. We provide livestreaming, video production, recording studio space, equipment rental .
    US spirinityproductions.com/services/live-streaming-los-angeles/
  • Spreadsheet Daddy
    Spreadsheet Daddy is an online resource providing actionable Microsoft Excel & Google Sheets tutorials, helping thousands of people master the art of working with spreadsheets. Operating Hours: Monday to Sunday 12:00 PM - 12:00 PM
    US spreadsheetdaddy.com
  • Alpine Garage Door Repair Lockhart Co.
    We provide top-quality garage door services! From garage door repair to garage door maintenance and new garage door installation, our technicians can do it all. Alpine Garage Doors is one of the leading garage door companies offering top-quality service and products to its customers. We have been in the garage door industry for more than 10 years with many satisfied customers. Our team of garage door technicians is very skilled and highly experienced. We have the solution to every garage door problem. We offer different garage door services such as repair, maintenance, and installation. With all our years of experience, we have the skills and knowledge to deal with every garage door make and model. You can call us anytime for top-rated garage door service and our technicians are available 24/7 to assist you.
    US alpinegaragedoorstx.com/locations/lockhart/
  • Coastal Brush Control LLC
    Coastal Brush Control provide forest mulching which is an economical, quick and environmentally friendly method of land clearing that eliminates the hauling away of trees, branches and other debris.
    US coastalbrushcontrol.com/
  • Tree Service
    Superior Tree Service in Palm Bay, FL, with ISA-Certified Arborists offering Competitive Pricing!
    US www.eastcoastarborprofl.com
  • Dumpster Rental Frisco TX
    As a business owner or as a homeowner, we understand the constraints you have on your time. We’ll work with your schedule for dumpster delivery and pick-up. Professional, friendly service at reasonable prices. Dumpster Rental Frisco TX provides a wide selection of dumpster rental services in Frisco and nearby areas.
    US dumpsterrentalfriscotx.com
  • Alpine Garage Door Repair Riverside Co.
    We provide top-quality garage door services! From garage door repair to garage door maintenance and new garage door installation, our technicians can do it all. Alpine Garage Doors is one of the leading garage door companies offering top-quality service and products to its customers. We have been in the garage door industry for more than 10 years with many satisfied customers. Our team of garage door technicians is very skilled and highly experienced. We have the solution to every garage door problem. We offer different garage door services such as repair, maintenance, and installation. With all our years of experience, we have the skills and knowledge to deal with every garage door make and model. You can call us anytime for top-rated garage door service and our technicians are available 24/7 to assist you.
    US alpinegaragedoorstx.com/locations/riverside/