Directory > Business > Business Services
- The Belkin Authorized Repair & Service Center
Repair Service Center USA can be your best choice to get your devices fixed instantly at affordable service charges all over the US. The entire troubleshooting process is overseen by technical executives and professionals. You can also opt for the official Belkin Service Center if your devices are malfunctioning and are under warranty.
www.repair-service-center.com/belkin/belkin-service-center.php - Camino Coin Company
Camino Coin Company is known for its world-class precious metal collection and its passion to serve its clients with the best customer experience. We deliver a large selection of bullion coins, jewelry, collectible stamps, mementos, and other currency. You can buy gold bullion online along with silver, platinum, palladium, and other notable metals with utmost transparency and trust.
caminocompany.com/ - Mississippi Dry Ice Blasting
Mississippi Dry Ice Blasting provides environmentally friendly, fast, cost-effective solutions to the toughest cleaning challenges. Mississippi Dry Ice Blasting services their clients with the best solution possible.
dryiceblastingmississippi.com/ - D & D 24/7 Roadside Service - (662) 258-1011
Roadside Assistance Service, Roadside Assistance, Roadside Service, Roadside Emergency Assistance, Roadside Tire Service We focus on satisfaction and better quality service so we can make sure that everyone is happy. Call us now if you need our services! Tremont MS; Cadamy MS; Smithville, MS; Amory, MS; Hatley, MSTire Change, Gas Delivery, Service Trailer, Truck Service, Transmissions, Rear-Ends, Tire Brakes, Oil Change
ddroadsideservice.com/ - Golf management
Golf management has the know-how to oversee all aspects of your golf course maintenance business. Our ability to be transparent with our partners sets us apart. As a company made up of golf course superintendents, we have the expertise to develop maintenance standards that distinguish you in your particular market. Then, to generate raving fans and ensure 100% membership/guest/customer satisfaction on each visit, we establish thorough and effective budgets that guarantee the maintenance requirements are delivered consistently. We can help assure top-notch golf course conditioning because of our years of knowledge and work with hundreds of golf courses, allowing you to focus on other important areas of the property. You can able to keep management of your asset because we work closely with you on this.
www.dte.golf/ - ShiftWeb | We help you do better online
Most business owners lack the time and expertise to build an online marketing plan that will get positive results. ShiftWeb will design an effective marketing plan that aligns who you are with what you do, and then execute it so you can grow your business and live a more fulfilling life. We offer a range of digital marketing and web maintenance solutions to help your business grow and thrive online. Our services include web design, SEO, email marketing, and more.
shiftweb.com - SMS-BUS
We locate at: 1325 Palmetto St, Los Angeles, CA 90013 USA. Call us: (805) 723-0672
sms-bus.com - Network management and configuration service providers
Privately held and steadily profitable, LogicVein has been focused on the network management domain for over a decade as a respected provider of innovative solutions. We are pleased to introduce Net LineDancer.
www.logicvein.com/ - Social Media Content Creation & Management Company
A top social media management company & agency. We've helped small businesses rapidly grow. Get results with our social media and SEO services.
digitalmediarun.com/ - Miltees Sprinkler And Valve Repair LLC - (805) 303-5142
Lawn Sprinkler, Lawn Sprinkler System, Lawn Sprinkler Repair, Lawn Sprinkler Installation, Professional Sprinkler Repair Miltees Sprinkler And Valve Repair LLC provide excellent Lawn Sprinkler Systems in Simi Valley, CA. Don't hesitate to contact us now! Westlake Village CA; Fillmore CA; Encino CA; Topanga CA; Hidden Hills CA;Professional Local Lawn Services, Affordable Commercial Sprinkler Services, Professional Residential Lawn Expert, Professional Commercial Sprinkler Cleaning, Affordable Landscaping Services Expert, Professional Residential Lawn Cleaning, Dependable Local Sprinkler Services, Reliable Local Lawn Services, Reliable Commercial Sprinkler Cleaning, Quality Affordable Lawn Cleaning.
lawnsprinklersystemssimivalley.com/ - RJ Tree Service Pros
RJ Tree Service Pros is an insured and licensed tree removal company that serves Durham and the surrounding areas. We are experts in tree removal, tree trimming & pruning, land clearing & more. Your trusted & professional tree service company in Durham NC
www.treeserviceprosdurham.com/ - Alpine Garage Door Repair Rockdale Co.
We provide top-quality garage door services! From garage door repair to garage door maintenance and new garage door installation, our technicians can do it all. Alpine Garage Doors is one of the leading garage door companies offering top-quality service and products to its customers. We have been in the garage door industry for more than 10 years with many satisfied customers. Our team of garage door technicians is very skilled and highly experienced. We have the solution to every garage door problem. We offer different garage door services such as repair, maintenance, and installation. With all our years of experience, we have the skills and knowledge to deal with every garage door make and model. You can call us anytime for top-rated garage door service and our technicians are available 24/7 to assist you.
alpinegaragedoorstx.com/locations/rockdale/ - CW Dumpsters, LLC
We locate at: Jacksonville, FL 32234 USA. Call us: (904) 591-7431
www.rentcwdumpsters.com - Weaver Septic Service LLC - (903) 437-2863
Septic System, Septic System Service, Septic Tank Treatment, Septic Tank Inspection, Septic System Installation Weaver Septic Service LLC gives you the top-quality septic system services that you deserve. For more information about our services and pricing please feel free to call us. Gallatin TX, Palestine TX, Whitehouse TX, Rusk TX, Bullard Town TXSeptic System Expert, Septic Company, Septic Treatment, Septic Inspection, Affordable Septic Installation, Trustworthy Septic System, Trusted Septic System Services.
septicsystemjacksonville.com/ - Boss Services, Inc.
Whether it is painting your home, adding a deck or an addition onto your home that meets the highest quality standards for engineering safety, structural integrity and craftsmanship, Boss Services, Inc. is the right choice. Holding ourselves to a higher standard since our conception in 1988, we have grown to become one of New Englands most successful custom residential building, remodeling and painting companies. We have assembled a team of the finest-trained carpenters, painters, designers, architects, and engineers available.
www.bossservicesinc.com - IPTVRESALE VS SSTV IPTV Comparison ,Who Is The Best IPTV
IPTV is much more than just on-demand video and lives TV broadcasts and streaming channels. Apps are used to stream content by IPTV service providers. Only a smart TV or computer with an internet connection can be used to stream content from some providers. Its vital to keep in mind that certain IPTV service providers only provide access using a certain device at a time. Even though some enable concurrent streaming on many devices. You must choose how and when to access your stuff in light of this. Once youve chosen your preferred device. Youll need to focus your search on IPTV service providers who can accommodate it. I think everyone has a certain preference for the types of things they enjoy seeing. Its crucial to review the list of channels offered before choosing your next IPTV service provider. Consider whether they satisfy your entertainment demands. Different bundles are available from a variety of suppliers.
iptvresale.com/ - GoldMaids Team
Address: 3806 Falling Acorn Cir, Lake Mary, FL 32746 Phone: 407-480-7439 GoldMaids Team delivers professional residential and commercial cleaning services in Lake Mary & surrounding areas in Central Florida to help promote healthy work & home environments.
www.goldmaidsteam.com - The Dumpster Divers
We Locate at: 3A Industrial Dr, Shrewsbury, MA 01545, Call us at: (508) 925-5245
www.thedumpsterdivers.com/ - Apopka Tree Pros
Are you looking for outstanding, affordable tree service in Apopka? Look no further! Apopka Tree Pros can help. We are a fully licensed and insured tree service company in Apopka, Florida. We have the highest trained professionals and latest equipment to complete any tree trimming or tree removal, from small residential yards to larger commercial jobs. We do: Tree trimming, tree removals, land clearing, stump grinding, storm removal. Call us today for a FREE Estimate
www.apopkatreepros.com - G Brothers Garage Doors
G Brothers Garage Doors handles all your Lakewood & Denver garage door needs, you can be sure that youre receiving quality services from a garage door company that you can trust.
www.gbrothersgaragedoors.com/
